Welcome to TradeChina
展商中心
Help
Online service on our app
TradeChina
ProductSupplier
Cart
AccountJoin
Sign In
Enquiries
Message
Home > Products > Packaging & Printing > Jar
In stock 100g/60pcs Eye mask jar black with hand pull pad and Spoon cosmetic eye mask packaging box ps material injection
  • In stock 100g/60pcs Eye mask jar black with hand pull pad and Spoon cosmetic eye mask packaging box ps material injection
  • In stock 100g/60pcs Eye mask jar black with hand pull pad and Spoon cosmetic eye mask packaging box ps material injection
  • In stock 100g/60pcs Eye mask jar black with hand pull pad and Spoon cosmetic eye mask packaging box ps material injection
  • In stock 100g/60pcs Eye mask jar black with hand pull pad and Spoon cosmetic eye mask packaging box ps material injection
  • In stock 100g/60pcs Eye mask jar black with hand pull pad and Spoon cosmetic eye mask packaging box ps material injection
  • In stock 100g/60pcs Eye mask jar black with hand pull pad and Spoon cosmetic eye mask packaging box ps material injection
  • In stock 100g/60pcs Eye mask jar black with hand pull pad and Spoon cosmetic eye mask packaging box ps material injection
  • In stock 100g/60pcs Eye mask jar black with hand pull pad and Spoon cosmetic eye mask packaging box ps material injection

In stock 100g/60pcs Eye mask jar black with hand pull pad and Spoon cosmetic eye mask packaging box ps material injection

FOB Reference Price
Purchase quantity ()
Minimum order quantity
Payment
Enquire
Add to Cart
Guangzhou Weiming Packaging Technology Co.,Ltd
Guangzhou Weiming Packaging Technology Co.,Ltd
China - Guangzhou
Manufacturer
Trade Capacity
Export Percentage
Nearest Port
guangzhou,Shenzhen
Accepted Delivery Terms
FOB,EXW
Employees
51-100 people
Accepted Payment Currency
USD
Average Lead Time
25 Day(s)
Certifications
Chat NowRequest meeting
Product Details
Product SpecificationsProduct Description
Product Specifications
Plastic Type
HDPE
Base Material
PS
Body Material
Glass
Use
Blush
Cap Material
Glass
Product Description
Overview
Quick Details
Place of Origin:
Guangdong, China
Brand Name:
Winin
Industrial Use:
Cosmetic  
Use:
SKIN CARE
Material Structure:
PS
Printing Handling:
Varnishing
Custom Order:
Accept
Feature:
Recycled Materials
Plastic Type:
ps
Material:
ps
Packaging & Delivery
Product Description
In stock 100g/60pcs Eye mask jar black with hand pull pad and Spoon cosmetic eye mask packaging box ps material injection from China supplier
Product Name
PET BOTTLE
Main Ingredient
PET Plastic
use
Containers for emulsions, water and other liquids
Volume
Customization of various models
In stock 100g/60pcs Eye mask jar black with hand pull pad and Spoon cosmetic eye mask packaging box ps material injection from China supplier
In stock 100g/60pcs Eye mask jar black with hand pull pad and Spoon cosmetic eye mask packaging box ps material injection from China supplier
In stock 100g/60pcs Eye mask jar black with hand pull pad and Spoon cosmetic eye mask packaging box ps material injection from China supplier
In stock 100g/60pcs Eye mask jar black with hand pull pad and Spoon cosmetic eye mask packaging box ps material injection from China supplier
In stock 100g/60pcs Eye mask jar black with hand pull pad and Spoon cosmetic eye mask packaging box ps material injection from China supplier
In stock 100g/60pcs Eye mask jar black with hand pull pad and Spoon cosmetic eye mask packaging box ps material injection from China supplier
In stock 100g/60pcs Eye mask jar black with hand pull pad and Spoon cosmetic eye mask packaging box ps material injection from China supplier
Certificate
In stock 100g/60pcs Eye mask jar black with hand pull pad and Spoon cosmetic eye mask packaging box ps material injection from China supplier
In stock 100g/60pcs Eye mask jar black with hand pull pad and Spoon cosmetic eye mask packaging box ps material injection from China supplier
In stock 100g/60pcs Eye mask jar black with hand pull pad and Spoon cosmetic eye mask packaging box ps material injection from China supplier
Packing & Delivery
In stock 100g/60pcs Eye mask jar black with hand pull pad and Spoon cosmetic eye mask packaging box ps material injection from China supplier
In stock 100g/60pcs Eye mask jar black with hand pull pad and Spoon cosmetic eye mask packaging box ps material injection from China supplier
In stock 100g/60pcs Eye mask jar black with hand pull pad and Spoon cosmetic eye mask packaging box ps material injection from China supplier
In stock 100g/60pcs Eye mask jar black with hand pull pad and Spoon cosmetic eye mask packaging box ps material injection from China supplier
Company Introduction
Guangzhou Wei Lin plastic co., ltd., founded in 2008, is a collection of plastic mold development, design and manufacturing in a body specialized companies,but also focus on plastic products production and processing product development , the product widely cosmetics industry.
In stock 100g/60pcs Eye mask jar black with hand pull pad and Spoon cosmetic eye mask packaging box ps material injection from China supplier
In stock 100g/60pcs Eye mask jar black with hand pull pad and Spoon cosmetic eye mask packaging box ps material injection from China supplier
FAQ
Q:What is your MOQ?
A:Generally speaking, our MOQ is 100 sets, which varies with different products.

Q:What is the advantage about your company?
A:Our company has professional team and professional production line.

Q:Why should I choose your products?
A:20000 style products. Our products are high quality and low price.

Q:The logo and the color can be customized?
A:Yes, OEM/ODM welcome, and sample fee 300USD is free.

Q:Any other good service your company can provide?
A: Yes, our team have 12 years experience, we can provide good after-sale and fast delivery.

In stock 100g/60pcs Eye mask jar black with hand pull pad and Spoon cosmetic eye mask packaging box ps material injection from China supplier
In stock 100g/60pcs Eye mask jar black with hand pull pad and Spoon cosmetic eye mask packaging box ps material injection from China supplier
In stock 100g/60pcs Eye mask jar black with hand pull pad and Spoon cosmetic eye mask packaging box ps material injection from China supplier
In stock 100g/60pcs Eye mask jar black with hand pull pad and Spoon cosmetic eye mask packaging box ps material injection from China supplier
In stock 100g/60pcs Eye mask jar black with hand pull pad and Spoon cosmetic eye mask packaging box ps material injection from China supplier
In stock 100g/60pcs Eye mask jar black with hand pull pad and Spoon cosmetic eye mask packaging box ps material injection from China supplier
In stock 100g/60pcs Eye mask jar black with hand pull pad and Spoon cosmetic eye mask packaging box ps material injection from China supplier
In stock 100g/60pcs Eye mask jar black with hand pull pad and Spoon cosmetic eye mask packaging box ps material injection from China supplier
In stock 100g/60pcs Eye mask jar black with hand pull pad and Spoon cosmetic eye mask packaging box ps material injection from China supplier
In stock 100g/60pcs Eye mask jar black with hand pull pad and Spoon cosmetic eye mask packaging box ps material injection from China supplier

No desirable products?
How to start your business
  • Step 1
    Find your interested products by search keywords
  • Step 2
    Contact the supplier by clicking ”Enquire” or “request meeting” button, otherwise, you also could consult our import consultant.
  • Step 3
    After verifying your email, get response from suppliers or our trade manager will contact you as soon as possible
  • Step 4
    Set up meeting with the Chinese supplier without language barrier
Send Enquiry
To: winin
Guangzhou Weiming Packaging Technology Co.,Ltd
Enquire
Supplier's popular products
Advanced cosmetic packaging acrylic bottle emulsion press-separated bottles
Advanced cosmetic packaging acrylic bottle emulsion press-separated bottles
US $0.88 ~$0.9
>=500 Piece
Enquire
Skin care products female facial anti-aging repair kit polypeptide retinol lightening cream skin care package shell
Skin care products female facial anti-aging repair kit polypeptide retinol lightening cream skin care package shell
US $0.6 ~$1.3
>=500 Piece
Enquire
Acrylic gradient set bottle spray 130ml 110ml 60ml 30ml cosmetic emulsion spray bottle cream can
Acrylic gradient set bottle spray 130ml 110ml 60ml 30ml cosmetic emulsion spray bottle cream can
US $0.8 ~$0.82
>=500 Piece
Enquire
Essential Oil perfume press sub-bottle sub-package cream bottles, acrylic crystal bottles cosmetics factory direct sales
Essential Oil perfume press sub-bottle sub-package cream bottles, acrylic crystal bottles cosmetics factory direct sales
US $0.93 ~$0.95
>=500 Piece
Enquire
Wholesale factory emulsion bottles empty acrylic square bottles sub-bottling
Wholesale factory emulsion bottles empty acrylic square bottles sub-bottling
US $0.78 ~$1.3
>=500 Piece
Enquire
High-end lotion Essence Toner Cream Package Bottle Cosmetics sub-bottle
High-end lotion Essence Toner Cream Package Bottle Cosmetics sub-bottle
US $0.78 ~$1.3
>=500 Piece
Enquire
Empty Cosmetic Packaging 15ml 30ml 50ml 100ml 120ml 30g 50g Skin Care Acrylic Lotion Pump Bottle And Cream Jar
Empty Cosmetic Packaging 15ml 30ml 50ml 100ml 120ml 30g 50g Skin Care Acrylic Lotion Pump Bottle And Cream Jar
US $0.78 ~$1.3
>=500 Piece
Enquire
Cosmetic container face cream plastic 100g PP plastic jar cosmetic jar cream
Cosmetic container face cream plastic 100g PP plastic jar cosmetic jar cream
US $0.22 ~$0.24
>=500 Piece
Enquire
high-grade foundation box BB cream repair look air cushion empty box, make-up air cushion box
high-grade foundation box BB cream repair look air cushion empty box, make-up air cushion box
US $0.83 ~$0.85
>=500 Piece
Enquire
The new technology of three-dimensional concave-convex embossing is used to process the skin patch of the air-cushion eye shadow
The new technology of three-dimensional concave-convex embossing is used to process the skin patch of the air-cushion eye shadow
US $0.83 ~$0.85
>=500 Piece
Enquire
Factory wholesale Round Empty BB Air Cushion Powder Case Plastic Custom Decoration Foundation Powder Container Compact Case
Factory wholesale Round Empty BB Air Cushion Powder Case Plastic Custom Decoration Foundation Powder Container Compact Case
US $0.5 ~$0.89
>=500 Piece
Enquire
High Quality Ready Stock Empty BB Cream Air Cushion Box Foundation Case ContaineEmpty BB Cream Air Cushion Box Container Container
High Quality Ready Stock Empty BB Cream Air Cushion Box Foundation Case ContaineEmpty BB Cream Air Cushion Box Container Container
US $0.83 ~$0.85
>=500 Piece
Enquire
Related Categories
FIBCBagHotStampingFoilOtherPackagingMaterialsPackagingLabelPrintingServicesProtective&CushioningMaterial
Popular Searches
tarpxtarnarasari.carvwar.carsarifarnyarakaripaprxtarkariharunarsyarnzarukarisbar